PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 348aa    MW: 36561.6 Da    PI: 8.6928
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-3966124361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+ 
  XP_015890106.1  66 SENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNI 124
                     57899***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.2E-3368123IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2569120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54469123IPR003851Zinc finger, Dof-type
PROSITE patternPS01361071107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MIQELLGGAG LIAGERKISI HGGRVLEATP PLSHSPSHSS SSSSSSTTTT TATTATTSSA  60
ATTSNSENLR CPRCDSSNTK FCYYNNYNLT QPRHFCKTCR RYWTKGGALR NVPIGGGCRK  120
NKNISVSASV AAKTSAGKMK MVASDIGVRS GFCGGGGFDH ELPASPILWG SPQNSHLLTL  180
LRSTQNPNPS SLCNSMAVKE ESGMIGSHMM TEQAVVASGS MNGRSCSLGL DPVLGQVPSL  240
GLCSSFWRSN QNHQPPTHQQ NGFVVGEVQS NGIQELYQRL RSSANYYGDH SAVVLTNVGS  300
SSSSSSSSSA STMTTSILES APVSGGELGY WNPAFSWSDL PTTNGAYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150343e-40AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866679.10.0PREDICTED: dof zinc finger protein DOF1.1-like
RefseqXP_015890106.10.0PREDICTED: dof zinc finger protein DOF1.1-like
TrEMBLA9P9B51e-137A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.14e-33Dof family protein